Pay in 4 interest-free payments of $359.62 Learn more
Ships within 48 hours · Estimated delivery Aug 30 - Sep 4
88:97-98(2000)
This subunit is the signaling component coupling to the JAK2/STAT4 pathway
AA Sequence:MSLALTNLLRQARTGLLLLLVATAGLGLVYPLAVFAVGRLVPARADGQVVAVDGQPVGSR LIGQEFPGEQWFQPRPSAAGDGYDPTASGASNLGPESTDLLKAVEERRAAVAAADGTAPV DVAPDALTASGSGLDPHVSPENARRQVARVAAARGLSEQRVAALVAEHTRGRALGFLGEP TVNVLELNLALRSAAP
Protein Names:Recommended name: Alkaline phosphatase
Recombinant Rat E3 ubiquitin-protein ligase RNF103(Rnf103) Blunt-end Cloning Kits 88:97-98(2000)Size: 50 ug. Other sizes are also available. Product Type: Recombinant Protein Species: Rattus norvegicus (Rat) Uniprot NO.: Q9EPZ8 Tag Info: The tag type will be determined during production process. Storage Buffer: Tris based buffer,50% glycerol, optimized for this protein Storage: Store at 20, for extended storage, conserve at 20 or 80. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 for up to one week. AA
![Living Artifact [Unlimited Edition] San Diego Comic-Con 2013](https://cdn.shopify.com/s/files/1/0267/9501/6251/products/9a40cbe3-e53d-57e4-a094-0e52cb73f325.jpg?v=1700204456)
![Pathbreaker Ibex [Commander Anthology] Mythic](https://cdn.shopify.com/s/files/1/0267/9501/6251/products/a6b07e99-21d1-5da2-b672-65f136aafa5c.jpg?v=1700204490)
US$ 1197.50
![Gifts Ungiven [From the Vault: Exiled] Ixalan Treasure Chest](https://cdn.shopify.com/s/files/1/0267/9501/6251/products/526cbd31-c014-5e66-820f-7f6c4118e647.jpg?v=1700204488)
US$ 2749.50
US$ 1487.00
![City of Brass [Modern Masters] Jace](https://cdn.shopify.com/s/files/1/0267/9501/6251/products/9218bcdd-c7be-56c5-8a22-93f7b92278dd.jpg?v=1700204501)
US$ 24.50
![Memnite (Game Day) (Extended Art) [Scars of Mirrodin Promos] Elephant Wizard](https://cdn.shopify.com/s/files/1/0267/9501/6251/products/57d33df0-85b3-5121-93e1-54c001edad08.jpg?v=1700204477)
US$ 1999.50
